LL-37 – Human Cathelicidin Peptide | 5mg

LL-37 – Human Cathelicidin Peptide | 5mg Lyophilized Powder | RUO Grade | BlueBiotech® Research Supply

Antimicrobial & Immunomodulatory Peptide for Host Defense and Inflammation Research | Made in USA | Research Use Only

LL-37 is a human cathelicidin-derived antimicrobial peptide known for its dual role in host defense and inflammation modulation. It is widely studied in the contexts of bacterial resistance, tissue regeneration, and skin immune signaling. Supplied as RUO-grade 5mg lyophilized powder. For Research Use Only – Not for human or veterinary use.

Field Name	Example Value
Product Name	LL-37 – Human Cathelicidin Peptide \| 5mg Lyophilized Powder \| RUO Grade \| BlueBiotech® Research Supply
Product Code	BBT-US-30-699793
Product Type	Research Peptide
Category	Peptides / Antimicrobial / Inflammation / Wound Healing / Innate Immunity
Manufacturer	BlueBiotech® Research Facility
Appearance	White lyophilized powder
Dosage / Units	5mg per vial
Purity	≥99% (HPLC)
Quantity Options	2mg / 5mg / 10mg
Storage	Store at -20°C; protect from moisture and light
Shelf Life	24 months unopened
Packaging	RUO-labeled sterile 10R vial, foil pouch
Manufacturer Origin	USA – Made in USA
Use Classification	RUO – Research Use Only (Not intended for human or veterinary use)
Tags	LL-37, cathelicidin, antimicrobial peptide, wound healing, inflammation research, BlueBiotech, RUO, 5mg, made in USA, innate immunity peptide

⚠️This product is labeled for Research Use Only (RUO). Not for human or veterinary therapeutic use.
See RUO Declaration for more info.

LL-37 | Human Antimicrobial Peptide for Immunity & Wound Healing Research

Category: Peptides → Innate Immunity / Antimicrobial / Tissue Repair
CAS No.: 219685-94-4
Sequence: [LL-37, 37 aa]
Molecular Formula: C204H345N59O54
Synonyms: Cathelicidin LL-37, hCAP-18 (C-terminal peptide)
Purity: ≥99% (HPLC)

Scientific Overview

LL-37 is the only human cathelicidin-derived antimicrobial peptide (AMP) identified to date, playing a vital role in innate immunity. Derived from the C-terminal domain of hCAP-18, LL-37 exhibits broad-spectrum antimicrobial activity, direct anti-biofilm effects, and the ability to modulate host immune responses.

In addition to its antimicrobial properties, LL-37 is a key regulator in wound healing, tissue regeneration, and inflammatory balance, and has been studied for its roles in chronic infections, autoimmune skin conditions, and tumor immunology.

Key Research Applications

Innate immune activation and pathogen clearance models
Antibacterial, antiviral, antifungal, and anti-biofilm research
Epithelial wound healing and re-epithelialization studies
Inflammatory skin diseases (psoriasis, rosacea)
Immunomodulation and cytokine expression regulation
Tumor microenvironment, angiogenesis, and apoptosis research

Highlighted Research Publications

Broad-Spectrum Antimicrobial Function
LL-37 disrupts bacterial membranes and inhibits biofilm formation
Infection and Immunity, 2000
Wound Healing & Tissue Repair
LL-37 promotes keratinocyte migration and angiogenesis during skin regeneration
Journal of Investigative Dermatology, 2004
Immunomodulation and Cytokine Control
LL-37 balances pro- and anti-inflammatory signals in host defense
Journal of Immunology, 2005
Anti-Tumor & Pro-Angiogenic Effects
LL-37 exhibits dual roles in cancer models via immune and vascular modulation
Cancer Research, 2009

Product Format & Notes

Form:White lyophilized peptide powder
Solubility:Soluble in sterile water, DMSO, or PBS
Storage:–20°C, light-protected and desiccated
Recommended Use:Immunity, infection biology, regenerative medicine, oncology

For Research Use Only

This product is intended strictly for scientific research purposes only. It is not for human use, clinical application, or diagnostic procedures. All use must comply with institutional and regulatory guidelines.

Also in GLP-1 Peptides:

Corporate Advantages

High-Purity Standards

Tested for purity and identity. COAs available
for all RUO compounds

Buyer Protection

Protected and discrete fulfillment
available upon request

Research-Grade Support

Dedicated service for labs, clinics, and
compounders handling RUO items.

Lab-Grade Quality Assurance

All compounds are tested for-identity and purity, COAs and supporting documentation are available upon request.

Strict RUO Compliance

All products are labeled for Researd Use Only (RUO), Not intended for human or veterinary therapeutic or diagnostic purposes.

Lab-Grade Quality Assurance

Custom branding.
white-label optionons and formulation assistancee available for eligible research institutions and partners.

Custom R&D & APl Synthesis

We support original
pharmaceutica solutions.custom research projects, and NDC-grade materials-meeting speifica.tions for qualified partners.

Serving Professionals Across the U.S.& Mexico

Trusted by MedSpas, wellness clinics and licensed compounders under licensed compounding relationships.

Secure & Discreet Fulfillment

Cold-chain shipping : private, plain.wrap packaging, and tracking for sensitive RUO materials.

⚠️ All compounds are provided strictly for Research Use Only (RUO). BLUEBIOTECH does not endorse or support clinical, therapeutic, or diagnostic use of its products unless under licensed compounder supervision.

LL-37 – Human Cathelicidin Peptide | 5mg