LL37
Antimicrobial peptide studied for innate immunity and wound healing.
| Field Name | Example Value |
| Product Name | LL37 |
| Product Code | BBT-US-30-699793 |
| Product Type | Peptide |
| Category | Peptides/Healing & Tissue Repair Peptides |
| Manufacturer | BLUEBIOTECH |
| Appearance | Lyophilized powder |
| Dosage / Units | 5mg |
| Purity | ≥ 99% HPLC |
| Storage | Store at 2°C to 8°C. Protect from light and moisture. |
| Shelf Life | 24 months when properly stored |
| Packaging | Sterile vial, vacuum-sealed, labeled for research use only |
| Manufacturer Origin | United States |
| Use Classification | RUO – Research Use Only (Not for human therapeutic use) |
| Tags：LL37 Peptide, Antimicrobial, Tissue Repair, Immune Regulation |
⚠️This product is labeled for Research Use Only (RUO). Not for human or veterinary therapeutic use.
See RUO Declaration for more info.
LL-37 | Human Antimicrobial Peptide for Immunity & Wound Healing Research
Category: Peptides → Innate Immunity / Antimicrobial / Tissue Repair
CAS No.: 219685-94-4
Sequence: [LL-37, 37 aa]
Molecular Formula: C204H345N59O54
Synonyms: Cathelicidin LL-37, hCAP-18 (C-terminal peptide)
Purity: ≥99% (HPLC)
Scientific Overview
LL-37 is the only human cathelicidin-derived antimicrobial peptide (AMP) identified to date, playing a vital role in innate immunity. Derived from the C-terminal domain of hCAP-18, LL-37 exhibits broad-spectrum antimicrobial activity, direct anti-biofilm effects, and the ability to modulate host immune responses.
In addition to its antimicrobial properties, LL-37 is a key regulator in wound healing, tissue regeneration, and inflammatory balance, and has been studied for its roles in chronic infections, autoimmune skin conditions, and tumor immunology.
Key Research Applications
- Innate immune activation and pathogen clearance models
- Antibacterial, antiviral, antifungal, and anti-biofilm research
- Epithelial wound healing and re-epithelialization studies
- Inflammatory skin diseases (psoriasis, rosacea)
- Immunomodulation and cytokine expression regulation
- Tumor microenvironment, angiogenesis, and apoptosis research
Highlighted Research Publications
- Broad-Spectrum Antimicrobial Function
LL-37 disrupts bacterial membranes and inhibits biofilm formation
Infection and Immunity, 2000 - Wound Healing & Tissue Repair
LL-37 promotes keratinocyte migration and angiogenesis during skin regeneration
Journal of Investigative Dermatology, 2004 - Immunomodulation and Cytokine Control
LL-37 balances pro- and anti-inflammatory signals in host defense
Journal of Immunology, 2005 - Anti-Tumor & Pro-Angiogenic Effects
LL-37 exhibits dual roles in cancer models via immune and vascular modulation
Cancer Research, 2009
Product Format & Notes
- Form:White lyophilized peptide powder
- Solubility:Soluble in sterile water, DMSO, or PBS
- Storage:–20°C, light-protected and desiccated
- Recommended Use:Immunity, infection biology, regenerative medicine, oncology
For Research Use Only
This product is intended strictly for scientific research purposes only. It is not for human use, clinical application, or diagnostic procedures. All use must comply with institutional and regulatory guidelines.
Also in GLP-1 Peptides:
Similar Products
![Rybelsus® Oral Semaglutide Tablets [Japan Edition]](https://www.bluebiotech.health/wp-content/uploads/2024/11/RYBELSUS-Semaglutide-Tablets-14.0-600x800.jpg)
Corporate Advantages
High-Purity Standards
Tested for purity and identity. COAs available
for all RUO compounds
Buyer Protection
Protected and discrete fulfillment
available upon request
Research-Grade Support
Dedicated service for labs, clinics, and
compounders handling RUO items.
Lab-Grade Quality Assurance
All compounds are tested for-identity and purity, COAs and supporting documentation are available upon request.
Strict RUO Compliance
All products are labeled for Researd Use Only (RUO), Not intended for human or veterinary therapeutic or diagnostic purposes.
Lab-Grade Quality Assurance
Custom branding.
white-label optionons and formulation assistancee available for eligible research institutions and partners.
Custom R&D & APl Synthesis
We support original
pharmaceutica solutions.custom research projects, and NDC-grade materials-meeting speifica.tions for qualified partners.
Serving Professionals Across the U.S.& Mexico
Trusted by MedSpas, wellness clinics and licensed compounders under licensed compounding relationships.
Secure & Discreet Fulfillment
Cold-chain shipping : private, plain.wrap packaging, and tracking for sensitive RUO materials.
⚠️ All compounds are provided strictly for Research Use Only (RUO). BLUEBIOTECH does not endorse or support clinical, therapeutic, or diagnostic use of its products unless under licensed compounder supervision.